PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G04860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 206aa    MW: 21650 Da    PI: 4.2623
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G04860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.4e-131353446
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      +  E e ++ + k+lG++ W+ Ia++m+ gRt++++k++w++
  OGLUM01G04860.1 13 ISDREAETIISLQKLLGNR-WSVIAAKMP-GRTDNEIKNYWNS 53
                     577899*************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-21158IPR009057Homeodomain-like
SuperFamilySSF466897.4E-13160IPR009057Homeodomain-like
PROSITE profilePS5129420.552559IPR017930Myb domain
SMARTSM007173.8E-12957IPR001005SANT/Myb domain
CDDcd001675.80E-101252No hitNo description
PfamPF002496.3E-111453IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MNYLRPDLKK EPISDREAET IISLQKLLGN RWSVIAAKMP GRTDNEIKNY WNSRIRKRQS  60
AAAGSGGCPT TGTVMEKEPT ANAATVAAAP EAASPPPPPI PARLPMFSCQ LLDGGGGAAA  120
TTQSPPNAGS SDISEVSACG GNGRGEDSSR DYCFSGGDVD GDGDMVHLLA LDDLDLLVDV  180
PGLLDVDAWD CELYRADYST SSSMSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-1325851107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0029120.0AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
GenBankAP0033390.0AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAY4593430.0AY459343.1 Oryza sativa (japonica cultivar-group) clone CL018501.1 R2R3-MYB gene region.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694952.13e-90PREDICTED: myb-related protein Hv33-like
TrEMBLA0A0D9Y3T81e-150A0A0D9Y3T8_9ORYZ; Uncharacterized protein
STRINGORGLA01G0040600.11e-143(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.22e-22myb domain protein 15